Loading...
Statistics
Advertisement

Maruto Sea Vegetables Inc.
www.maruto-usa.com/

Maruto-usa.com

Advertisement
Maruto-usa.com is hosted in United States / Englewood . Maruto-usa.com uses HTTPS protocol. Number of used technologies: 2. First technologies: CSS, Javascript, Number of used javascripts: 0. Number of used analytics tools: 0. Its server type is: Rapidsite/Apa/1.3.33 (Unix) FrontPage/5.0.2.2510 mod_ssl/2.8.22 OpenSSL/0.9.8d.

Technologies in use by Maruto-usa.com

Technology

Number of occurences: 2
  • CSS
  • Javascript

Advertisement

Server Type

  • Rapidsite/Apa/1.3.33 (Unix) FrontPage/5.0.2.2510 mod_ssl/2.8.22 OpenSSL/0.9.8d

Conversion rate optimization

visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Maruto-usa.com

SSL certificate

    • name: /serialNumber=QGSKD1uFe2RNH9G4n0L3hbfx/PrVzpjS/C=US/ST=Colorado/L=Englewood/O=Verio Inc./OU=Secure Services Division/CN=*.dulles19-verio.com
    • subject:
      • serialNumber: QGSKD1uFe2RNH9G4n0L3hbfx/PrVzpjS
      • C: US
      • ST: Colorado
      • L: Englewood
      • O: Verio Inc.
      • OU: Secure Services Division
      • CN: *.dulles19-verio.com
    • hash: 7e852ab4
    • issuer:
      • C: US
      • O: GeoTrust, Inc.
      • CN: GeoTrust SSL CA
    • version: 2
    • serialNumber: 49856
    • validFrom: 110726134741Z
    • validTo: 160727194217Z
    • validFrom_time_t: 1311688061
    • validTo_time_t: 1469648537
    • extensions:
      • authorityKeyIdentifier: keyid:42:79:54:1B:61:CD:55:2B:3E:63:D5:3C:48:57:F5:9F:FB:45:CE:4A
      • keyUsage: Digital Signature, Key Encipherment, Data Encipherment
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • subjectAltName: DNS:*.dulles19-verio.com, DNS:dulles19-verio.com
      • crlDistributionPoints: Full Name: URI:http://gtssl-crl.geotrust.com/crls/gtssl.crl
      • subjectKeyIdentifier: 08:0B:37:94:C4:F2:F2:D0:15:97:21:A1:07:F5:45:1D:A9:6C:91:5A
      • basicConstraints: CA:FALSE
      • authorityInfoAccess: CA Issuers - URI:http://gtssl-aia.geotrust.com/gtssl.crt

Meta - Maruto-usa.com

Number of occurences: 3
  • Name:
    Content: text/javascript
  • Name: keywords
    Content: maruto sea vegetables,gardena,sake,nori,sake,dry foods,sushi nori
  • Name: GENERATOR
    Content: ホームページNinja2003+ネットショップ for Windows Product Version 3.0.2

Server / Hosting

  • IP: 204.200.202.167
  • Latitude: 39.62
  • Longitude: -104.87
  • Country: United States
  • City: Englewood

Rname

  • ns19b.nameservers.net
  • ns19a.nameservers.net
  • mail-fwd.mx.g19.rapidsite.net

Target

  • hostmaster.rapidsite.net

HTTP Header Response

HTTP/1.1 200 OK Date: Mon, 13 Jun 2016 18:47:04 GMT Server: Rapidsite/Apa/1.3.33 (Unix) FrontPage/5.0.2.2510 mod_ssl/2.8.22 OpenSSL/0.9.8d Last-Modified: Wed, 10 Feb 2010 18:20:15 GMT ETag: "35689c8-1ed4-4b72f8df" Accept-Ranges: bytes Content-Length: 7892 Content-Type: text/html X-Cache: MISS from s_xt50 X-Cache-Lookup: MISS from s_xt50:80 Via: 1.1 s_xt50 (squid/3.5.14) Connection: keep-alive

DNS

host: maruto-usa.com
  1. class: IN
  2. ttl: 86400
  3. type: A
  4. ip: 204.200.202.167
host: maruto-usa.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns19b.nameservers.net
host: maruto-usa.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns19a.nameservers.net
host: maruto-usa.com
  1. class: IN
  2. ttl: 86400
  3. type: SOA
  4. mname: feed19.nameservers.net
  5. rname: hostmaster.rapidsite.net
  6. serial: 2009061210
  7. refresh: 7200
  8. retry: 3600
  9. expire: 604800
  10. minimum-ttl: 86400
host: maruto-usa.com
  1. class: IN
  2. ttl: 69395
  3. type: MX
  4. pri: 50
  5. target: mail-fwd.mx.g19.rapidsite.net

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.aruto-usa.com, www.mparuto-usa.com, www.paruto-usa.com, www.moaruto-usa.com, www.oaruto-usa.com, www.miaruto-usa.com, www.iaruto-usa.com, www.mkaruto-usa.com, www.karuto-usa.com, www.m.aruto-usa.com, www..aruto-usa.com, www.muaruto-usa.com, www.uaruto-usa.com, www.mjaruto-usa.com, www.jaruto-usa.com, www.mnaruto-usa.com, www.naruto-usa.com, www.m-aruto-usa.com, www.-aruto-usa.com, www.mruto-usa.com, www.maoruto-usa.com, www.moruto-usa.com, www.mapruto-usa.com, www.mpruto-usa.com, www.ma9ruto-usa.com, www.m9ruto-usa.com, www.maruto-usa.com, www.mruto-usa.com, www.mairuto-usa.com, www.miruto-usa.com, www.mauruto-usa.com, www.muruto-usa.com, www.mauto-usa.com, www.mariuto-usa.com, www.maiuto-usa.com, www.marouto-usa.com, www.maouto-usa.com, www.marluto-usa.com, www.maluto-usa.com, www.marluto-usa.com, www.maluto-usa.com, www.mar.uto-usa.com, www.ma.uto-usa.com, www.marto-usa.com, www.maruwto-usa.com, www.marwto-usa.com, www.marueto-usa.com, www.mareto-usa.com, www.marusto-usa.com, www.marsto-usa.com, www.maruato-usa.com, www.marato-usa.com, www.maruo-usa.com, www.marutqo-usa.com, www.maruqo-usa.com, www.marutao-usa.com, www.maruao-usa.com, www.marut o-usa.com, www.maru o-usa.com, www.marutwo-usa.com, www.maruwo-usa.com, www.maruteo-usa.com, www.marueo-usa.com, www.marutzo-usa.com, www.maruzo-usa.com, www.marutxo-usa.com, www.maruxo-usa.com, www.marutco-usa.com, www.maruco-usa.com, www.marut-usa.com, www.marutob-usa.com, www.marutb-usa.com, www.marutoh-usa.com, www.maruth-usa.com, www.marutog-usa.com, www.marutg-usa.com, www.marutoj-usa.com, www.marutj-usa.com, www.marutom-usa.com, www.marutm-usa.com, www.maruto -usa.com, www.marut -usa.com, www.marutov-usa.com, www.marutv-usa.com, www.marutousa.com, www.maruto-tusa.com, www.marutotusa.com, www.maruto-gusa.com, www.marutogusa.com, www.maruto-husa.com, www.marutohusa.com, www.maruto-uusa.com, www.marutouusa.com, www.maruto-jusa.com, www.marutojusa.com, www.maruto-xusa.com, www.marutoxusa.com, www.maruto-susa.com, www.marutosusa.com, www.maruto-ausa.com, www.marutoausa.com, www.maruto-usa.com, www.marutousa.com, www.maruto- usa.com, www.maruto usa.com, www.maruto-sa.com, www.maruto-uwsa.com, www.maruto-wsa.com, www.maruto-uesa.com, www.maruto-esa.com, www.maruto-ussa.com, www.maruto-ssa.com, www.maruto-uasa.com, www.maruto-asa.com, www.maruto-ua.com, www.maruto-usea.com, www.maruto-uea.com, www.maruto-uswa.com, www.maruto-uwa.com, www.maruto-usda.com, www.maruto-uda.com, www.maruto-usxa.com, www.maruto-uxa.com, www.maruto-usfa.com, www.maruto-ufa.com, www.maruto-usga.com, www.maruto-uga.com, www.maruto-usta.com, www.maruto-uta.com, www.maruto-us.com, www.maruto-usao.com, www.maruto-uso.com, www.maruto-usap.com, www.maruto-usp.com, www.maruto-usa9.com, www.maruto-us9.com, www.maruto-usa.com, www.maruto-us.com, www.maruto-usai.com, www.maruto-usi.com, www.maruto-usau.com, www.maruto-usu.com,

Other websites we recently analyzed

  1. electricknifesharpenerreviews.com
    Frankfurt (Germany) - 149.126.77.93
    Server software:
    Technology: Html, Iframe, Incapsula, Javascript
    Number of Javascript: 1
    Number of meta tags: 4
  2. injunctionagainstharassment.com
    Scottsdale (United States) - 50.63.202.51
    Server software: Microsoft-IIS/7.5
    Technology: Html, Html5, Iframe
  3. MarketSurf by Stella MORABITO
    Mountain View (United States) - 172.217.22.51
    Server software: GSE
    Technology: CSS, Feedburner, Html, Javascript, Php, Geovisite, Google +1 Button
    Number of Javascript: 7
    Number of meta tags: 2
  4. Millennial Wealth Advisors -
    San Antonio (United States) - 162.242.223.227
    G Analytics ID: UA-61857809-1
    Server software: nginx
    Technology: BootstrapCDN, Maxcdn, CSS, Font Awesome, Html, Html5, Javascript, jQuery, Php, Pingback, Google Analytics, Wordpress
    Number of Javascript: 8
    Number of meta tags: 5
  5. 常州市景华纺织有限公司
    Orange (United States) - 98.126.56.66
    Server software: Microsoft-IIS/6.0
    Technology: CSS, Html, Swf Object
    Number of meta tags: 1
  6. winterbark.com
    Switzerland - 141.8.224.183
    Server software: Apache
    Technology: Html
  7. Couv'Oise – Le labo des entrepreneurs de l'Oise
    Amblainville (France) - 109.2.165.142
    G Analytics ID: UA-75087917-1
    Server software: Apache/2.2.10 (Win32)
    Technology: CSS, Html, Html5, Javascript, jQuery, Php, Pingback, Google Analytics, Wordpress
    Number of Javascript: 6
    Number of meta tags: 4
  8. Welcome to N4R.COM
    Scottsdale (United States) - 184.168.221.96
    Server software: Microsoft-IIS/7.5
    Technology: Google Adsense, CSS, Html, Javascript
    Number of Javascript: 3
    Number of meta tags: 1
  9. PHHHONE
    Maker of fine iphone cases. Showcase for some items we design and release.
    New York (United States) - 66.6.44.4
    Server software: Varnish
    Technology: CloudFlare, CSS, Html, Html5, Iframe, Javascript, jQuery Colorbox, SVG, Google Analytics, Tumblr
    Number of Javascript: 4
    Number of meta tags: 103
  10. Fondation Aristote - Innovation éducative
    France - 213.186.33.16
    Server software: Apache
    Technology: Carousel, CSS, Font Awesome, Html, Html5, Javascript, jQuery, Php, Pingback, SVG, Google Analytics, Hotjar, Optimizely, Wordpress
    Number of Javascript: 39
    Number of meta tags: 6

Check Other Websites